- glucagon-Like Peptide
- glucagon-Like Peptide
-
péptido derivado del proglucagón dotado de potentes propiedades insulinotrópicas
Diccionario ilustrado de Términos Médicos.. Alvaro Galiano. 2010.
Diccionario médico. 2013.
Diccionario ilustrado de Términos Médicos.. Alvaro Galiano. 2010.
Diccionario médico. 2013.
Glucagon-like peptide-1 — (GLP 1) is derived from the transcription product of the proglucagon gene. The major source of GLP 1 in the body is the intestinal L cell that secretes GLP 1 as a gut hormone. The biologically active forms of GLP 1 are: GLP 1 (7 37) and GLP 1 (7… … Wikipedia
Glucagon-like-peptide 1 — Masse/Länge Primärstruktur 37 Aminosäuren … Deutsch Wikipedia
Glucagon-like peptide-2 — (GLP 2) is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP 2 is created by specific post translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon like… … Wikipedia
Glucagon-like peptide 1 receptor — The glucagon like peptide 1 receptor (GLP1R) is a human gene which resides on chromosome 6.cite journal | author = Thorens B | title = Expression cloning of the pancreatic beta cell receptor for the gluco incretin hormone glucagon like peptide 1… … Wikipedia
Glucagon-like peptide 2 receptor — The gene for the glucagon like peptide 2 receptor (GLP 2) is on chromosome 17.cite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon receptor family of G protein coupled receptors: the glucagon, GIP, GLP 1,… … Wikipedia
glucagon-like peptide — (GLP) either of two intestinal peptide hormones (GLP 1 and GLP 2) secreted by the L cells in response to ingestion of nutrients, especially carbohydrates and fat rich meals. GLP 1 inhibits gastric emptying, food intake, and glucagon secretion and … Medical dictionary
Glucagon — is an important hormone involved in carbohydrate metabolism. Produced by the pancreas, it is released when the glucose level in the blood is low (hypoglycemia), causing the liver to convert stored glycogen into glucose and release it into the… … Wikipedia
Glucagon receptor family — The glucagon receptor familycite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon receptor family of G protein coupled receptors: the glucagon, GIP, GLP 1, and GLP 2 receptors | journal = Recept. Channels |… … Wikipedia
Glucagon receptor — The glucagon receptor is a 62 kDa peptide that is activated by glucagon and is a member of the G protein coupled family of receptors, coupled to Gs.cite journal | author = Brubaker PL, Drucker DJ | title = Structure function of the glucagon… … Wikipedia
Glucagon hormone family — Pfam box Symbol = Hormone 2 Name = width = caption = Glucagon (PDB3|1gcn) Pfam= PF00123 InterPro= IPR000532 SMART= Prosite = PDOC00233 SCOP = 1gcn TCDB = OPM family= OPM protein= 1gcn PDB=PDB3|1geaA:132 151 PDB3|1d0rA:98 125 PDB3|1jrjA:48… … Wikipedia